What is the catalog number for TOP3A Peptide - C-terminal region?

The catalog number for TOP3A Peptide - C-terminal region is orb1998726.

What sizes are available for TOP3A Peptide - C-terminal region?

TOP3A Peptide - C-terminal region is available in the following size(s): 100 µg.

Is TOP3A Peptide - C-terminal region in stock?

TOP3A Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

TOP3A Peptide - C-terminal region

Product Specifications

Product Name Alternative

TOP3, ZGRF7

UniProt

Q13472

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004609.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CLCSQPSVTRTVQKDGPNKGRQFHTCAKPREQQCGFFQWVDENTAPGTSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A52359-100 100 µL

ALDOA Polyclonal Antibody, HRP Conjugated

Sign In for Pricing

View Details

APR08241G-01 50 µL

LIPC Antibody (N-term) [APR08241G]

Sign In for Pricing

View Details

APR08241G-02 100 µL

LIPC Antibody (N-term) [APR08241G]

Sign In for Pricing

View Details

APR08241G-03 200 µL

LIPC Antibody (N-term) [APR08241G]

Sign In for Pricing

View Details

APR08241G-04 400 µL

LIPC Antibody (N-term) [APR08241G]

Sign In for Pricing

View Details

MBS7068850 Inquire

Recombinant Rhizobium sp. UPF0314 protein NGR_c32320 (NGR_c32320), partial

Sign In for Pricing

View Details