PJA1 Peptide - middle region
PJA1 Peptide - middle region
Product Specifications
Product Name Alternative
RNF70, PRAJA1
UniProt
O43164
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001027568.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LDGNNNLEDDSSVSEDLEVDWSLFDGFADGLGVAEAISYVDPQFLTYMAL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6007893-01 0.1 mg
CD11b, Active (Integrin alpha-M, CD11 Antigen-like family Member B, CR-3 alpha Chain, Cell Surface Glycoprotein MAC-1 Subunit alpha, Leukocyte Adhesion Receptor MO1, Neutrophil Adherence Receptor, ITGAM, CR3A)
Sign In for Pricing
View Details MBS6007893-02 5x 0.1 mg
CD11b, Active (Integrin alpha-M, CD11 Antigen-like family Member B, CR-3 alpha Chain, Cell Surface Glycoprotein MAC-1 Subunit alpha, Leukocyte Adhesion Receptor MO1, Neutrophil Adherence Receptor, ITGAM, CR3A)
Sign In for Pricing
View Details 
MBS2506778-01 24 Tests
Rabbit GRalpha (Glucocorticoid Receptor Alpha) ELISA Kit
Sign In for Pricing
View Details MBS2506778-02 48 Tests
Rabbit GRalpha (Glucocorticoid Receptor Alpha) ELISA Kit
Sign In for Pricing
View Details MBS2506778-03 96 Tests
Rabbit GRalpha (Glucocorticoid Receptor Alpha) ELISA Kit
Sign In for Pricing
View Details MBS2506778-04 5x 96 Tests
Rabbit GRalpha (Glucocorticoid Receptor Alpha) ELISA Kit
Sign In for Pricing
View Details