Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PJA1 Peptide - middle region

PJA1 Peptide - middle region

Product Specifications

Product Name Alternative

RNF70, PRAJA1

UniProt

O43164

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001027568.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDGNNNLEDDSSVSEDLEVDWSLFDGFADGLGVAEAISYVDPQFLTYMAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TANK Protein
E30P939 20 µg

Recombinant Human TANK Protein

Sign In for Pricing
View Details
GPX1 Antibody
orb789355 2 mg

GPX1 Antibody

Sign In for Pricing
View Details
Nrf2 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61093R-BF594 100 µL

Nrf2 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Anti-METTL18 Antibody Picoband®, iFluor647 Conjugate
A15133-iFluor647 100 µg

Anti-METTL18 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
LTB CRISPR Knock Out 293T Cell Line (Human)
27763141 1x 10^6 Cells / 1.0 mL

LTB CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
TAB1 Blocking Peptide
MBS9626819-01 1 mg

TAB1 Blocking Peptide

Sign In for Pricing
View Details