Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MICAL2 Peptide - N-terminal region

MICAL2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MICAL-2, MICAL2PV1, MICAL2PV2

UniProt

O94851

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001269592.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KALWYKLDKRGSHKEYKRGKSCTNTKCLIVGGGPCGLRTAIELAYLGAKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HTRA2 Mouse Monoclonal Antibody
AMM82268-01 1 Each

HTRA2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
HTRA2 Mouse Monoclonal Antibody
AMM82268-02 50 µL

HTRA2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
HTRA2 Mouse Monoclonal Antibody
AMM82268-03 100 µL

HTRA2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Endophilin-A3, SH3GL3 ELISA Kit
MBS9321441-01 48 Well

Mouse Endophilin-A3, SH3GL3 ELISA Kit

Sign In for Pricing
View Details
Mouse Endophilin-A3, SH3GL3 ELISA Kit
MBS9321441-02 96 Well

Mouse Endophilin-A3, SH3GL3 ELISA Kit

Sign In for Pricing
View Details
Mouse Endophilin-A3, SH3GL3 ELISA Kit
MBS9321441-03 5x 96 Well

Mouse Endophilin-A3, SH3GL3 ELISA Kit

Sign In for Pricing
View Details