Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MICAL2 Peptide - N-terminal region

MICAL2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MICAL-2, MICAL2PV1, MICAL2PV2

UniProt

O94851

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001269592.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KALWYKLDKRGSHKEYKRGKSCTNTKCLIVGGGPCGLRTAIELAYLGAKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABA B Receptor 1 Rabbit mAb
56239 50 µL

GABA B Receptor 1 Rabbit mAb

Sign In for Pricing
View Details
Human Complement Factor B (CFB) ELISA Kit
DLR-CFB-Hu-01 48 Tests

Human Complement Factor B (CFB) ELISA Kit

Sign In for Pricing
View Details
Human Complement Factor B (CFB) ELISA Kit
DLR-CFB-Hu-02 96 Tests

Human Complement Factor B (CFB) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Vmn2r66 shRNA (UAS) - Lentiviral mouse Vmn2r66 shRNA (UAS) (100)
GTR15250890 1 Vial

Lentiviral mouse Vmn2r66 shRNA (UAS) - Lentiviral mouse Vmn2r66 shRNA (UAS) (100)

Sign In for Pricing
View Details
Gas2 (F-12) Alexa Fluor® 790
sc-398669 AF790 200 µg/mL

Gas2 (F-12) Alexa Fluor® 790

Sign In for Pricing
View Details
HO1 Protein (N-His, Human)
P515709 100 µg

HO1 Protein (N-His, Human)

Sign In for Pricing
View Details