Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CATSPERB Peptide - middle region

CATSPERB Peptide - middle region

Product Specifications

Product Name Alternative

C14orf161, CatSper (beta)

UniProt

Q9H7T0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_079040.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IPLTDNFYHADPSKPIPRNMFHMSKKTGKFKQCANVSTREECNCTKDQKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Chloroimidazo[1,2-a]pyridine-6-carbonitrile
TRC-C382930-25MG 25 mg

2-Chloroimidazo[1,2-a]pyridine-6-carbonitrile

Sign In for Pricing
View Details
Inosine triphosphate pyrophosphatase (ITPA) (NM_033453) Human Recombinant Protein
TP720525 10 µg

Inosine triphosphate pyrophosphatase (ITPA) (NM_033453) Human Recombinant Protein

Sign In for Pricing
View Details
PAMR1 Human qPCR Primer Pair (NM_015430)
HP234111 200 Reactions

PAMR1 Human qPCR Primer Pair (NM_015430)

Sign In for Pricing
View Details
3-O-TBS Delta5-Avenasterol (E/Z mixture)
TRC-A795820-5MG 5 mg

3-O-TBS Delta5-Avenasterol (E/Z mixture)

Sign In for Pricing
View Details
TRAM2 Rabbit Polyclonal Antibody
TA362299 100 µL

TRAM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Isopyridoxal Hydrochloride
TRC-I824100-50MG 50 mg

Isopyridoxal Hydrochloride

Sign In for Pricing
View Details