Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CATSPERB Peptide - middle region

CATSPERB Peptide - middle region

Product Specifications

Product Name Alternative

C14orf161, CatSper (beta)

UniProt

Q9H7T0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_079040.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IPLTDNFYHADPSKPIPRNMFHMSKKTGKFKQCANVSTREECNCTKDQKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (NM_001780) Human Over-expression Lysate
LY419757 100 µg

CD63 (NM_001780) Human Over-expression Lysate

Sign In for Pricing
View Details
ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (23c), CF568 conjugate, 0.1mg/mL
BNC681474-500 1x 500 µL

ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (23c), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-[2-(2,4-Difluorophenyl)-2,3-epoxypropyl]-1H-1,2,4-triazole
TRC-D446045-500MG 500 mg

1-[2-(2,4-Difluorophenyl)-2,3-epoxypropyl]-1H-1,2,4-triazole

Sign In for Pricing
View Details
Dabrafenib-d9
TRC-D101002-25MG 25 mg

Dabrafenib-d9

Sign In for Pricing
View Details
Human Fractalkine/CX3CL1, C-His Tag (ECD)
HA211057-01 Inquire

Human Fractalkine/CX3CL1, C-His Tag (ECD)

Sign In for Pricing
View Details
Human Fractalkine/CX3CL1, C-His Tag (ECD)
HA211057-02 50 µg

Human Fractalkine/CX3CL1, C-His Tag (ECD)

Sign In for Pricing
View Details