Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSBPL1A Peptide - middle region

OSBPL1A Peptide - middle region

Product Specifications

Product Name Alternative

ORP1, ORP-1, OSBPL1B

UniProt

Q9BXW6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001229437.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LYSVDPATFDAYKKNDKKNTEEKKNSKQMSTSEELDEMPVPDSESVFIIP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Traf6 Mouse Gene Knockout Kit (CRISPR)
KN518129 1 Kit

Traf6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2717), CF568 conjugate, 0.1mg/mL
BNC682717-100 1x 100 µL

PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2717), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNK1 Mouse Monoclonal Antibody [Clone ID: 1B5G3]
AM06239SU-N 100 µL

TNK1 Mouse Monoclonal Antibody [Clone ID: 1B5G3]

Sign In for Pricing
View Details
XFD350 alkyne
70003-AAT 1 mg

XFD350 alkyne

Sign In for Pricing
View Details
AKT1 Rabbit Polyclonal Antibody
AP06368PU-N 100 µg

AKT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
APCDD1 (NM_153000) Human Recombinant Protein
TP308639 20 µg

APCDD1 (NM_153000) Human Recombinant Protein

Sign In for Pricing
View Details