Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D22A Peptide - N-terminal region

TBC1D22A Peptide - N-terminal region

Product Specifications

Product Name Alternative

C22orf4, HSC79E021

UniProt

Q8WUA7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001271232.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EFESNTSDAWDAGEDDDELLAMAAESLNSEVVMETANRVLRNHSQRQGRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATR Rabbit Polyclonal Antibody
HA500176 100 µL

ATR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD33 (NM_001177608) Human Over-expression Lysate
LC432863 20 µg

CD33 (NM_001177608) Human Over-expression Lysate

Sign In for Pricing
View Details
Hypoxanthine
TRC-H998500-25MG 25 mg

Hypoxanthine

Sign In for Pricing
View Details
rac Quinacrine-d10 Dihydrochloride
TRC-Q550612-1MG 1 mg

rac Quinacrine-d10 Dihydrochloride

Sign In for Pricing
View Details
CuLlin 3 (CuL3) (NM_003590) Human Recombinant Protein
TP308066M 100 µg

CuLlin 3 (CuL3) (NM_003590) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS707108 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details