Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D22A Peptide - N-terminal region

TBC1D22A Peptide - N-terminal region

Product Specifications

Product Name Alternative

C22orf4, HSC79E021

UniProt

Q8WUA7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001271232.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EFESNTSDAWDAGEDDDELLAMAAESLNSEVVMETANRVLRNHSQRQGRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human GPNMB Protein (aa 22-486, His Tag)
PKSH033371-01 10 µg

Recombinant Human GPNMB Protein (aa 22-486, His Tag)

Sign In for Pricing
View Details
Recombinant Human GPNMB Protein (aa 22-486, His Tag)
PKSH033371-02 50 µg

Recombinant Human GPNMB Protein (aa 22-486, His Tag)

Sign In for Pricing
View Details
EXTRAClean Urine Cell-Free Circulating RNA Purification Mini Kit
73900 50 Preparations

EXTRAClean Urine Cell-Free Circulating RNA Purification Mini Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS509925 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), Biotin conjugate, 0.1mg/mL
BNCB2383-500 1x 500 µL

CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gamma-Isodurylic Acid
TRC-I815120-10MG 10 mg

Gamma-Isodurylic Acid

Sign In for Pricing
View Details