Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AFTPH Peptide - N-terminal region

AFTPH Peptide - N-terminal region

Product Specifications

Product Name Alternative

Nbla10388

UniProt

Q6ULP2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001002243.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YSSSPPPLDNGAEDDDDDEFGEFGGFSEVSPSGVGFVDFDTPDYTRPKEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycidyl Caprylate
TRC-G615520-100MG 100 mg

Glycidyl Caprylate

Sign In for Pricing
View Details
CD47 (IAP/964), CF488A conjugate, 0.1mg/mL
BNC880964-100 1x 100 µL

CD47 (IAP/964), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RBPJK (RBPJ) Human Gene Knockout Kit (CRISPR)
KN204791LP 1 Kit

RBPJK (RBPJ) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CSPS (SULT1A3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A8]
TA811317AM 100 µL

CSPS (SULT1A3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A8]

Sign In for Pricing
View Details
Adenosine Monophosphate Deaminase 3 (AMPD3) (AMPD3/901), Biotin conjugate, 0.1mg/mL
BNCB0901-100 1x 100 µL

Adenosine Monophosphate Deaminase 3 (AMPD3) (AMPD3/901), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AF647 Anti-Mouse CD1d Antibody
RD20501F-01 25 µg

AF647 Anti-Mouse CD1d Antibody

Sign In for Pricing
View Details