Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AFTPH Peptide - N-terminal region

AFTPH Peptide - N-terminal region

Product Specifications

Product Name Alternative

Nbla10388

UniProt

Q6ULP2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001002243.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YSSSPPPLDNGAEDDDDDEFGEFGGFSEVSPSGVGFVDFDTPDYTRPKEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Synaptophysin/SYP Monoclonal Antibody
AN300291P 100 µL

Recombinant Synaptophysin/SYP Monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast, left
CS711347 5x 5 µm

Tissue FFPE Sections, Breast, left

Sign In for Pricing
View Details
2,5-Dichlorophenylboronic Acid
TRC-D436550-5G 5 g

2,5-Dichlorophenylboronic Acid

Sign In for Pricing
View Details
Recombinant CDK4 Antibody
RC-5282-01 50 μL

Recombinant CDK4 Antibody

Sign In for Pricing
View Details
Recombinant CDK4 Antibody
RC-5282-02 100 µL

Recombinant CDK4 Antibody

Sign In for Pricing
View Details
Recombinant CDK4 Antibody
RC-5282-03 1 mL

Recombinant CDK4 Antibody

Sign In for Pricing
View Details