Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASP1 Peptide - middle region

CASP1 Peptide - middle region

Product Specifications

Product Name Alternative

ICE, P45, IL1BC

UniProt

P29466

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001214.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKS

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal to Human V1RL1 / VN1R1
MBS244174-01 0.05 mg

Rabbit Polyclonal to Human V1RL1 / VN1R1

Sign In for Pricing
View Details
Rabbit Polyclonal to Human V1RL1 / VN1R1
MBS244174-02 5x 0.05 mg

Rabbit Polyclonal to Human V1RL1 / VN1R1

Sign In for Pricing
View Details
Mouse Psmb3 (NM_011971) AAV Particle
MR202155A1V 250 µL

Mouse Psmb3 (NM_011971) AAV Particle

Sign In for Pricing
View Details
Anti-Human EGF (S-177) Antibody
MBS4158306-01 0.1 mg

Anti-Human EGF (S-177) Antibody

Sign In for Pricing
View Details
Anti-Human EGF (S-177) Antibody
MBS4158306-02 5x 0.1 mg

Anti-Human EGF (S-177) Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Zika Virus (SPH2015) NS1 Antibody (10) [DyLight 405]
NBP3-05858V 0.1 mL

Mouse Monoclonal Zika Virus (SPH2015) NS1 Antibody (10) [DyLight 405]

Sign In for Pricing
View Details