Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASP1 Peptide - middle region

CASP1 Peptide - middle region

Product Specifications

Product Name Alternative

ICE, P45, IL1BC

UniProt

P29466

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001214.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Alpha-Fetoprotein (AFP) ELISA Kit
PRB-5058-5 5x 96 Assays

Human Alpha-Fetoprotein (AFP) ELISA Kit

Sign In for Pricing
View Details
Human BCL2L1/BCL-X (Bcl-2 Like Protein 1) ValidElisa Kit
EK340276 96 Well

Human BCL2L1/BCL-X (Bcl-2 Like Protein 1) ValidElisa Kit

Sign In for Pricing
View Details
Rat Coiled Coil Domain Containing Protein 80,CCDC80 ELISA KIT
JOT-EK0838Ra 96 wells

Rat Coiled Coil Domain Containing Protein 80,CCDC80 ELISA KIT

Sign In for Pricing
View Details
Akt1S1 antibody (Thr246)
70R-31330 100 ug

Akt1S1 antibody (Thr246)

Sign In for Pricing
View Details
Rabbit Creatine kinase S-type, mitochondrial (CKMT2) ELISA Kit
MBS7244286-01 48 Well

Rabbit Creatine kinase S-type, mitochondrial (CKMT2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Creatine kinase S-type, mitochondrial (CKMT2) ELISA Kit
MBS7244286-02 96 Well

Rabbit Creatine kinase S-type, mitochondrial (CKMT2) ELISA Kit

Sign In for Pricing
View Details