Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK2 Peptide - middle region

CDK2 Peptide - middle region

Product Specifications

Product Name Alternative

CDKN2, p33 (CDK2)

UniProt

P24941

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001277159.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Duck A-L-Iduronidase ELISA Kit
MBS058050 Inquire

Duck A-L-Iduronidase ELISA Kit

Sign In for Pricing
View Details
PIGM Adenovirus (Rat)
36657056 1.0 mL

PIGM Adenovirus (Rat)

Sign In for Pricing
View Details
Etilefrine hydrochloride
MBS3606748-01 25 mg

Etilefrine hydrochloride

Sign In for Pricing
View Details
Etilefrine hydrochloride
MBS3606748-02 5x 25 mg

Etilefrine hydrochloride

Sign In for Pricing
View Details
Human recombination activating gene 1 (RAG-1) ELISA Kit
MBS269841-01 48 Well

Human recombination activating gene 1 (RAG-1) ELISA Kit

Sign In for Pricing
View Details
Human recombination activating gene 1 (RAG-1) ELISA Kit
MBS269841-02 96 Well

Human recombination activating gene 1 (RAG-1) ELISA Kit

Sign In for Pricing
View Details