CDK2 Peptide - middle region
CDK2 Peptide - middle region
Product Specifications
Product Name Alternative
CDKN2, p33 (CDK2)
UniProt
P24941
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001277159.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
F8352 96 Tests
Phosphatidylinositol 4-Kinase α (PI4KA) Human ELISA Kit
Sign In for Pricing
View Details 
MBS206674-01 0.01 mg
TNFRSF12A, 28-80aa, Human, hIgG-His-tag, Baculovirus
Sign In for Pricing
View Details MBS206674-02 0.05 mg
TNFRSF12A, 28-80aa, Human, hIgG-His-tag, Baculovirus
Sign In for Pricing
View Details MBS206674-03 5x 0.01 mg
TNFRSF12A, 28-80aa, Human, hIgG-His-tag, Baculovirus
Sign In for Pricing
View Details MBS206674-04 0.25 mg
TNFRSF12A, 28-80aa, Human, hIgG-His-tag, Baculovirus
Sign In for Pricing
View Details