Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JUN Peptide - middle region

JUN Peptide - middle region

Product Specifications

Product Name Alternative

AP1, p39, AP-1, c-Jun

UniProt

P05412

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002219.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Yarrowia lipolytica NADH-ubiquinone oxidoreductase chain 4L (ND4L)
orb2935788-01 20 µg

Recombinant Yarrowia lipolytica NADH-ubiquinone oxidoreductase chain 4L (ND4L)

Sign In for Pricing
View Details
Recombinant Yarrowia lipolytica NADH-ubiquinone oxidoreductase chain 4L (ND4L)
orb2935788-02 100 µg

Recombinant Yarrowia lipolytica NADH-ubiquinone oxidoreductase chain 4L (ND4L)

Sign In for Pricing
View Details
Innovative Grade US Origin Fetal Bovine Spine Full Spine Fresh in Saline
IGFBSNEST1 1 Each

Innovative Grade US Origin Fetal Bovine Spine Full Spine Fresh in Saline

Sign In for Pricing
View Details
Canine Cadherin, Neuronal ELISA Kit
MBS741651-01 48 Well

Canine Cadherin, Neuronal ELISA Kit

Sign In for Pricing
View Details
Canine Cadherin, Neuronal ELISA Kit
MBS741651-02 96 Well

Canine Cadherin, Neuronal ELISA Kit

Sign In for Pricing
View Details
Canine Cadherin, Neuronal ELISA Kit
MBS741651-03 5x 96 Well

Canine Cadherin, Neuronal ELISA Kit

Sign In for Pricing
View Details