Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JUN Peptide - middle region

JUN Peptide - middle region

Product Specifications

Product Name Alternative

AP1, p39, AP-1, c-Jun

UniProt

P05412

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002219.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human GSC2 shRNA (UAS) - Lentiviral human GSC2 shRNA (UAS, GFP) (100)
GTR15350568 1 Vial

Lentiviral human GSC2 shRNA (UAS) - Lentiviral human GSC2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
LOXL2 Antibody
orb619335 100 µL

LOXL2 Antibody

Sign In for Pricing
View Details
At4g01160 Antibody
orb796306 2 mg

At4g01160 Antibody

Sign In for Pricing
View Details
Recombinant Human Ubiquitin-conjugating enzyme E2 D4 (UBE2D4)
orb1647583-01 20 µg

Recombinant Human Ubiquitin-conjugating enzyme E2 D4 (UBE2D4)

Sign In for Pricing
View Details
Recombinant Human Ubiquitin-conjugating enzyme E2 D4 (UBE2D4)
orb1647583-02 100 µg

Recombinant Human Ubiquitin-conjugating enzyme E2 D4 (UBE2D4)

Sign In for Pricing
View Details
Recombinant Human Ubiquitin-conjugating enzyme E2 D4 (UBE2D4)
orb1647583-03 1 mg

Recombinant Human Ubiquitin-conjugating enzyme E2 D4 (UBE2D4)

Sign In for Pricing
View Details