Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNNB1 Peptide - C-terminal region

CTNNB1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EVR7, CTNNB, MRD19, armadillo

UniProt

P35222

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001091679.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103D-01 50 Tests

PE Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details
PE Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103D-02 100 Tests

PE Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details
PE Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103D-03 2x 100 Tests

PE Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD24 Antibody[M1/69]
E-AB-F1179UQ-01 25 µg

Elab Fluor® Violet 450 Anti-Mouse CD24 Antibody[M1/69]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD24 Antibody[M1/69]
E-AB-F1179UQ-02 100 µg

Elab Fluor® Violet 450 Anti-Mouse CD24 Antibody[M1/69]

Sign In for Pricing
View Details
Power Supply for ProPette™
P6080-RC 1 Each

Power Supply for ProPette™

Sign In for Pricing
View Details