CUX1 Peptide - middle region
CUX1 Peptide - middle region
Product Specifications
Product Name Alternative
CDP, CUX, p75, CASP, CDP1, COY1, Clox, p100, p110, p200, CUTL1, GOLIM6, CDP/Cut, Cux/CDP, Nbla10317
UniProt
P39880
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001189473.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
13687151 3x 1.0 µg DNA
C11orf35 CRISPR All-in-one AAV vector set (with saCas9)(Human)
Sign In for Pricing
View Details 
PA1881-Biotin 100 µg/Vial
Anti-ErbB 4/ERBB4 Antibody Picoband® (Biotine Conjugate)
Sign In for Pricing
View Details 031095 200 µL
LTF (LTF, LF, Lactotransferrin, Talalactoferrin, Kaliocin-1, Lactoferroxin-A, Lactoferroxin-B, Lactoferroxin-C)
Sign In for Pricing
View Details