CUX1 Peptide - middle region
CUX1 Peptide - middle region
Product Specifications
Product Name Alternative
CDP, CUX, p75, CASP, CDP1, COY1, Clox, p100, p110, p200, CUTL1, GOLIM6, CDP/Cut, Cux/CDP, Nbla10317
UniProt
P39880
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001189473.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
EIA05787Rb 1 Kit
Rabbit heart fatty acid binding protein (h-FABP) ELISA Kit
Sign In for Pricing
View Details 
K2010804 1.0 µg DNA
RPS4P5 sgRNA CRISPR Lentivector (Human) (Target 3)
Sign In for Pricing
View Details 
LV631717 1.0 µg DNA
IL17RA Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details