Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF2A1 Peptide - middle region

GTF2A1 Peptide - middle region

Product Specifications

Product Name Alternative

TF2A1, TFIIA, TFIIAL, TFIIA-42

UniProt

P52655

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001265869.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wilm s Tumor 1 (WT1) (Wilm s Tumor & Mesothelial Marker) (rWT1/857), Biotin conjugate, 0.1mg/mL
BNCB1856-500 1x 500 µL

Wilm s Tumor 1 (WT1) (Wilm s Tumor & Mesothelial Marker) (rWT1/857), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calprotectin (S100A9) Mouse Monoclonal Antibody [Clone ID: OTI8C2]
CF804218 100 µg

Calprotectin (S100A9) Mouse Monoclonal Antibody [Clone ID: OTI8C2]

Sign In for Pricing
View Details
APC Anti-Human CD2 Antibody[RPA-2.10]
E-AB-F1375E-01 20 Tests

APC Anti-Human CD2 Antibody[RPA-2.10]

Sign In for Pricing
View Details
APC Anti-Human CD2 Antibody[RPA-2.10]
E-AB-F1375E-02 100 Tests

APC Anti-Human CD2 Antibody[RPA-2.10]

Sign In for Pricing
View Details
APC Anti-Human CD2 Antibody[RPA-2.10]
E-AB-F1375E-03 2x 100 Tests

APC Anti-Human CD2 Antibody[RPA-2.10]

Sign In for Pricing
View Details
Coelenterazine FCP
10117-1 1 mg

Coelenterazine FCP

Sign In for Pricing
View Details