Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF2A1 Peptide - middle region

GTF2A1 Peptide - middle region

Product Specifications

Product Name Alternative

TF2A1, TFIIA, TFIIAL, TFIIA-42

UniProt

P52655

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001265869.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Ovary
CR562099 5 µg

Tissue Total RNA, Ovary

Sign In for Pricing
View Details
ILF2 Human Gene Knockout Kit (CRISPR)
KN401751 1 Kit

ILF2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CEBP Alpha (CEBPA) Rabbit Polyclonal Antibody
AP06373PU-N 100 µg

CEBP Alpha (CEBPA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CLINT1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6G10]
TA805982BM 100 µL

CLINT1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6G10]

Sign In for Pricing
View Details
Metabotropic Glutamate Receptor 8 (GRM8) (NM_001127323) Human Over-expression Lysate
LY426746 100 µg

Metabotropic Glutamate Receptor 8 (GRM8) (NM_001127323) Human Over-expression Lysate

Sign In for Pricing
View Details
CA3 Antibody
KC-8147-01 50 μL

CA3 Antibody

Sign In for Pricing
View Details