Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNAI3 Peptide - middle region

GNAI3 Peptide - middle region

Product Specifications

Product Name Alternative

87U6, ARCND1

UniProt

P08754

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006487.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD28 Recombinant Rabbit monoclonal Antibody
HA723458 100 µL

Human CD28 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD50 (ICAM-3) (ICAM3/1019), CF640R conjugate, 0.1mg/mL
BNC401019-500 1x 500 µL

CD50 (ICAM-3) (ICAM3/1019), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HypoGel® 200 COOH
SP20011015003.100G 100 g

HypoGel® 200 COOH

Sign In for Pricing
View Details
Guanine-4,8-13C2,7-15N
TRC-G836002-25MG 25 mg

Guanine-4,8-13C2,7-15N

Sign In for Pricing
View Details
Tube Rack
R1060 5 Units/Pack

Tube Rack

Sign In for Pricing
View Details
Recombinant CD36 Antibody
RC-16952-01 50 μL

Recombinant CD36 Antibody

Sign In for Pricing
View Details