Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNAI3 Peptide - middle region

GNAI3 Peptide - middle region

Product Specifications

Product Name Alternative

87U6, ARCND1

UniProt

P08754

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006487.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP13 Antibody (HRP)
KH-2694-01 50 μL

MMP13 Antibody (HRP)

Sign In for Pricing
View Details
MMP13 Antibody (HRP)
KH-2694-02 100 µL

MMP13 Antibody (HRP)

Sign In for Pricing
View Details
MMP13 Antibody (HRP)
KH-2694-03 1 mL

MMP13 Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Human S100A6 Protein
PKSH031346 100 µg

Recombinant Human S100A6 Protein

Sign In for Pricing
View Details
Sncg (NM_011430) Mouse Tagged ORF Clone
MG200624 10 µg

Sncg (NM_011430) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Ferritin Conjugated Cancer antennarius Lectin (California Crab) -CCA-
I-7201-1 1 mg

Ferritin Conjugated Cancer antennarius Lectin (California Crab) -CCA-

Sign In for Pricing
View Details