Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POU2F1 Peptide - middle region

POU2F1 Peptide - middle region

Product Specifications

Product Name Alternative

OCT1, OTF1, oct-1B

UniProt

P14859

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001185712.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MEKEVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFPSPTSLVATTPSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Rat IgG1, κ Isotype Control[HRPN]
E-AB-F09823C-01 25 µg

FITC Rat IgG1, κ Isotype Control[HRPN]

Sign In for Pricing
View Details
FITC Rat IgG1, κ Isotype Control[HRPN]
E-AB-F09823C-02 100 µg

FITC Rat IgG1, κ Isotype Control[HRPN]

Sign In for Pricing
View Details
6-Hydroxy-2,4,5-triaminopyrimidine, Sulfate
TRC-H971250-2.5G 2.5 g

6-Hydroxy-2,4,5-triaminopyrimidine, Sulfate

Sign In for Pricing
View Details
Human Xeroderma Pigmentosum, Complementation Group G (XPG) ELISA Kit
RD-XPG-Hu-01 96 Tests

Human Xeroderma Pigmentosum, Complementation Group G (XPG) ELISA Kit

Sign In for Pricing
View Details
Human Xeroderma Pigmentosum, Complementation Group G (XPG) ELISA Kit
RD-XPG-Hu-02 48 Tests

Human Xeroderma Pigmentosum, Complementation Group G (XPG) ELISA Kit

Sign In for Pricing
View Details
LRPAP1 (NM_002337) Human Over-expression Lysate
LY419397 100 µg

LRPAP1 (NM_002337) Human Over-expression Lysate

Sign In for Pricing
View Details