Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POU2F1 Peptide - middle region

POU2F1 Peptide - middle region

Product Specifications

Product Name Alternative

OCT1, OTF1, oct-1B

UniProt

P14859

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001185712.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MEKEVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFPSPTSLVATTPSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRCA1 (Breast Marker) (BRCA1/2986), CF405S conjugate, 0.1mg/mL
BNC042986-100 1x 100 µL

BRCA1 (Breast Marker) (BRCA1/2986), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NEFM) Mouse Monoclonal Antibody [Clone ID: OTI5H4]
CF805947 100 µg

Neurofilament (NEFM) Mouse Monoclonal Antibody [Clone ID: OTI5H4]

Sign In for Pricing
View Details
MUC15 (NM_001135092) Human Over-expression Lysate
LY427548 100 µg

MUC15 (NM_001135092) Human Over-expression Lysate

Sign In for Pricing
View Details
D-[13C5]Xylose
TRC-X750758-5MG 5 mg

D-[13C5]Xylose

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS809191 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
N-[4-Chloro-2-(1-hydroxy-1-phenylethyl)phenyl]-urea
TRC-C585370-50MG 50 mg

N-[4-Chloro-2-(1-hydroxy-1-phenylethyl)phenyl]-urea

Sign In for Pricing
View Details