Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDM2 Peptide - middle region

MDM2 Peptide - middle region

Product Specifications

Product Name Alternative

HDMX, hdm2, ACTFS

UniProt

Q00987

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001138811.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hexokinase II (1E8) Mouse Monoclonal Antibody, 1 pack = 20 µL
BAL5515 1 Each

Hexokinase II (1E8) Mouse Monoclonal Antibody, 1 pack = 20 µL

Sign In for Pricing
View Details
TSC1, phosphorylated (Y304) (TSC1, KIAA0243, TSC, Hamartin, Tuberous sclerosis 1 protein) (PE) discontinued
043335-PE 200 µL

TSC1, phosphorylated (Y304) (TSC1, KIAA0243, TSC, Hamartin, Tuberous sclerosis 1 protein) (PE) discontinued

Sign In for Pricing
View Details
SPSB2-iNOS inhibitory cyclic peptide-1
TP2624-01 10 mg

SPSB2-iNOS inhibitory cyclic peptide-1

Sign In for Pricing
View Details
SPSB2-iNOS inhibitory cyclic peptide-1
TP2624-02 50 mg

SPSB2-iNOS inhibitory cyclic peptide-1

Sign In for Pricing
View Details
MECP2, Recombinant, Human, aa78-162, GST-Tag (Methyl CpG Binding Protein 2, Rett Syndrome)
298430 50 µg

MECP2, Recombinant, Human, aa78-162, GST-Tag (Methyl CpG Binding Protein 2, Rett Syndrome)

Sign In for Pricing
View Details
Recombinant Silicibacter pomeroyi Maf-like protein SPO3892 (SPO3892)
MBS1409683-01 0.02 mg (E-Coli)

Recombinant Silicibacter pomeroyi Maf-like protein SPO3892 (SPO3892)

Sign In for Pricing
View Details