Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAX5 Peptide - C-terminal region

PAX5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ALL3, BSAP

UniProt

Q02548

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001267476.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDHD1 (NM_007086) Human Recombinant Protein
TP316745 20 µg

WDHD1 (NM_007086) Human Recombinant Protein

Sign In for Pricing
View Details
ID3 (C-term) Rabbit Polyclonal Antibody
AP22732PU-N 250 µL

ID3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Zswim6 Mouse Gene Knockout Kit (CRISPR)
KN520167 1 Kit

Zswim6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
VILIP3 (HPCAL1) (NM_002149) Human Over-expression Lysate
LC419502 20 µg

VILIP3 (HPCAL1) (NM_002149) Human Over-expression Lysate

Sign In for Pricing
View Details
ReadiLink™ BSA Conjugation Kit
5501-AAT 2 Reactions

ReadiLink™ BSA Conjugation Kit

Sign In for Pricing
View Details
CT47A1 (NM_001080146) Human Over-expression Lysate
LC421602 20 µg

CT47A1 (NM_001080146) Human Over-expression Lysate

Sign In for Pricing
View Details