GNA12 Peptide - middle region
GNA12 Peptide - middle region
Product Specifications
Product Name Alternative
RMP, gep, NNX3
UniProt
Q03113
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001269370.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IILFLNKMDLLVEKVKTVSIKKHFPDFRGDPHRLEDVQRYLVQCFDRKRR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
SL0745Mo-01 48 Tests
Mouse Soluble Intercellular Adhesion Molecule-1 (sICAM-1) ELISA Kit
Sign In for Pricing
View Details SL0745Mo-02 96 Tests
Mouse Soluble Intercellular Adhesion Molecule-1 (sICAM-1) ELISA Kit
Sign In for Pricing
View Details 
489353 100 µL
PRIM1 (DNA Primase Small Subunit, Primase, DNA, Polypeptide 1 (49kD) )
Sign In for Pricing
View Details