Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XRCC6 Peptide - C-terminal region

XRCC6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ML8, KU70, TLAA, CTC75, CTCBF, G22P1

UniProt

P12956

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001275905.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPML

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC8 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B2]
TA809667BM 100 µL

HDAC8 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B2]

Sign In for Pricing
View Details
SYPL1 Human Gene Knockout Kit (CRISPR)
KN402334 1 Kit

SYPL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(17Alpha)-17-Hydroxy-19-norpregn-5-en-20-yn-3-one Cyclic 1,2-Ethanediyl Acetal
TRC-H949000-25MG 25 mg

(17Alpha)-17-Hydroxy-19-norpregn-5-en-20-yn-3-one Cyclic 1,2-Ethanediyl Acetal

Sign In for Pricing
View Details
LAG3 Antibody
KC-47733-01 50 μL

LAG3 Antibody

Sign In for Pricing
View Details
LAG3 Antibody
KC-47733-02 100 µL

LAG3 Antibody

Sign In for Pricing
View Details
LAG3 Antibody
KC-47733-03 1 mL

LAG3 Antibody

Sign In for Pricing
View Details