Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XRCC6 Peptide - C-terminal region

XRCC6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ML8, KU70, TLAA, CTC75, CTCBF, G22P1

UniProt

P12956

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001275905.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPML

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD84 (NM_001184881) Human Recombinant Protein
TP329804M 100 µg

CD84 (NM_001184881) Human Recombinant Protein

Sign In for Pricing
View Details
Phosphoserine (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 16B4]
AM00117PU-N 100 µg

Phosphoserine (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 16B4]

Sign In for Pricing
View Details
SGI-1027
TRC-S282375-1MG 1 mg

SGI-1027

Sign In for Pricing
View Details
Neurofilament (NF-H) (Neuronal Marker) (NEFL.H/2324R), CF405S conjugate, 0.1mg/mL
BNC042324-500 1x 500 µL

Neurofilament (NF-H) (Neuronal Marker) (NEFL.H/2324R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Syap1 Mouse Gene Knockout Kit (CRISPR)
KN517032 1 Kit

Syap1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Manual Pipette Controller BPIP-410
BPIP-410 1 Unit

Manual Pipette Controller BPIP-410

Sign In for Pricing
View Details