Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G4A Peptide - middle region

PLA2G4A Peptide - middle region

Product Specifications

Product Name Alternative

CPLA2, PLA2G4, cPLA2-alpha

UniProt

P47712

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001298122.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NRVLGVSGSQSRGSTMEEELENITTKHIVSNDSSDSDDESHEPKGTENED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Delphinidin-3,5-O-diglucoside chloride
M31221-01 100 mg

Delphinidin-3,5-O-diglucoside chloride

Sign In for Pricing
View Details
Delphinidin-3,5-O-diglucoside chloride
M31221-02 50 mg

Delphinidin-3,5-O-diglucoside chloride

Sign In for Pricing
View Details
Delphinidin-3,5-O-diglucoside chloride
M31221-03 500 mg

Delphinidin-3,5-O-diglucoside chloride

Sign In for Pricing
View Details
Delphinidin-3,5-O-diglucoside chloride
M31221-04 Inquire

Delphinidin-3,5-O-diglucoside chloride

Sign In for Pricing
View Details
Delphinidin-3,5-O-diglucoside chloride
M31221-05 5 mg

Delphinidin-3,5-O-diglucoside chloride

Sign In for Pricing
View Details
Met antibody
20R-2391 0.05 mg

Met antibody

Sign In for Pricing
View Details