PLA2G4A Peptide - middle region
PLA2G4A Peptide - middle region
Product Specifications
Product Name Alternative
CPLA2, PLA2G4, cPLA2-alpha
UniProt
P47712
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001298122.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SGSQSRGSTMEEELENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQ
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb1693278-01 5 mg
5-Phospho-D-ribose 1-diphosphate sodium salt hydrate
Sign In for Pricing
View Details orb1693278-02 10 mg
5-Phospho-D-ribose 1-diphosphate sodium salt hydrate
Sign In for Pricing
View Details 
orb1693278-03 25 mg
5-Phospho-D-ribose 1-diphosphate sodium salt hydrate
Sign In for Pricing
View Details orb1693278-04 100 mg
5-Phospho-D-ribose 1-diphosphate sodium salt hydrate
Sign In for Pricing
View Details