Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G4A Peptide - middle region

PLA2G4A Peptide - middle region

Product Specifications

Product Name Alternative

CPLA2, PLA2G4, cPLA2-alpha

UniProt

P47712

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001298122.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGSQSRGSTMEEELENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQ

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPHN Antibody - N-terminal region : Biotin (ARP51838_P050-Biotin)
ARP51838_P050-Biotin 100 µL

GPHN Antibody - N-terminal region : Biotin (ARP51838_P050-Biotin)

Sign In for Pricing
View Details
Lentiviral human KDM4E shRNA (UAS) - Lentiviral human KDM4E shRNA (UAS, RFP) (100)
GTR15318663 1 Vial

Lentiviral human KDM4E shRNA (UAS) - Lentiviral human KDM4E shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Meprin A subunit alpha
orb1639486-01 50 µg

Meprin A subunit alpha

Sign In for Pricing
View Details
Meprin A subunit alpha
orb1639486-02 100 µg

Meprin A subunit alpha

Sign In for Pricing
View Details
Meprin A subunit alpha
orb1639486-03 1 mg

Meprin A subunit alpha

Sign In for Pricing
View Details
Ethyl 1H-pyrrolo[3,2-b]pyridine-6-carboxylate
OR77418-01 100 mg

Ethyl 1H-pyrrolo[3,2-b]pyridine-6-carboxylate

Sign In for Pricing
View Details