Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNAI2 Peptide - C-terminal region

GNAI2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GIP, GNAI2B, H_LUCA15.1, H_LUCA16.1

UniProt

P04899

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001159897.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CFPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Neuron Derived Orphan Receptor 1 (NOR1) ELISA Kit
DLR-NOR1-Ra-48T 48 Tests

Rat Neuron Derived Orphan Receptor 1 (NOR1) ELISA Kit

Sign In for Pricing
View Details
Human Leptin (LEP) CLIA Kit
abx190061-01 96 Tests

Human Leptin (LEP) CLIA Kit

Sign In for Pricing
View Details
Human Leptin (LEP) CLIA Kit
abx190061-02 5x 96 Tests

Human Leptin (LEP) CLIA Kit

Sign In for Pricing
View Details
Human Leptin (LEP) CLIA Kit
abx190061-03 10x 96 Tests

Human Leptin (LEP) CLIA Kit

Sign In for Pricing
View Details
Vascular cell adhesion protein 1, 25-698aa, Mouse, His tag, Baculovirus
MBS206303-01 0.01 mg

Vascular cell adhesion protein 1, 25-698aa, Mouse, His tag, Baculovirus

Sign In for Pricing
View Details
Vascular cell adhesion protein 1, 25-698aa, Mouse, His tag, Baculovirus
MBS206303-02 0.05 mg

Vascular cell adhesion protein 1, 25-698aa, Mouse, His tag, Baculovirus

Sign In for Pricing
View Details