Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNAI2 Peptide - C-terminal region

GNAI2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GIP, GNAI2B, H_LUCA15.1, H_LUCA16.1

UniProt

P04899

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001159897.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CFPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC108 (CFAP65) (NM_152389) Human Untagged Clone
SC306385 10 µg

CCDC108 (CFAP65) (NM_152389) Human Untagged Clone

Sign In for Pricing
View Details
TOM34 Antibody
E38QA3015 100 µL

TOM34 Antibody

Sign In for Pricing
View Details
IKZF2 Antibody
E30AC2213 100 µL

IKZF2 Antibody

Sign In for Pricing
View Details
Tislelizumab (Anti-PDCD1 / PD-1 / CD279)
A3039-1mg*5 5x 1mg

Tislelizumab (Anti-PDCD1 / PD-1 / CD279)

Sign In for Pricing
View Details
ARAP1 Protein Vector (Human) (pPM-C-His)
PV062808 500 ng

ARAP1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
SASH1 Human qPCR Primer Pair (NM_015278)
HP211516 200 Reactions

SASH1 Human qPCR Primer Pair (NM_015278)

Sign In for Pricing
View Details