Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XRCC5 Peptide - middle region

XRCC5 Peptide - middle region

Product Specifications

Product Name Alternative

KU80, KUB2, Ku86, NFIV, KARP1, KARP-1

UniProt

P13010

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_066964.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4,4'-Diethylbiphenyl
TRC-D444878-500MG 500 mg

4,4'-Diethylbiphenyl

Sign In for Pricing
View Details
Mitochondria (Marker for Human Cells, Granular RCC's & Salivary Tumors) (MTC02/2860R), Biotin conjugate, 0.1mg/mL
BNCB2860-500 1x 500 µL

Mitochondria (Marker for Human Cells, Granular RCC's & Salivary Tumors) (MTC02/2860R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Homosalate
TRC-H614000-5G 5 g

Homosalate

Sign In for Pricing
View Details
Ube2v2 (NM_023585) Mouse Tagged ORF Clone
MG200961 10 µg

Ube2v2 (NM_023585) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
RANBP6 (NM_012416) Human Recombinant Protein
TP310538M 100 µg

RANBP6 (NM_012416) Human Recombinant Protein

Sign In for Pricing
View Details
2-Chloropyrimidine-d3 (Major)
TRC-C380852-5MG 5 mg

2-Chloropyrimidine-d3 (Major)

Sign In for Pricing
View Details