Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XRCC5 Peptide - middle region

XRCC5 Peptide - middle region

Product Specifications

Product Name Alternative

KU80, KUB2, Ku86, NFIV, KARP1, KARP-1

UniProt

P13010

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_066964.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GBA3 (NM_020973) Human Over-expression Lysate
LC402815 20 µg

GBA3 (NM_020973) Human Over-expression Lysate

Sign In for Pricing
View Details
Mal-PEG-NH2.HCl, 2K
HE022050-2K-01 1 g

Mal-PEG-NH2.HCl, 2K

Sign In for Pricing
View Details
Mal-PEG-NH2.HCl, 2K
HE022050-2K-02 5 g

Mal-PEG-NH2.HCl, 2K

Sign In for Pricing
View Details
Vat1 Mouse Gene Knockout Kit (CRISPR)
KN518859 1 Kit

Vat1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rat Urocortin 3 (UCN3) ELISA Kit
RD-UCN3-Ra-01 96 Tests

Rat Urocortin 3 (UCN3) ELISA Kit

Sign In for Pricing
View Details
Rat Urocortin 3 (UCN3) ELISA Kit
RD-UCN3-Ra-02 48 Tests

Rat Urocortin 3 (UCN3) ELISA Kit

Sign In for Pricing
View Details