Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XRCC5 Peptide - middle region

XRCC5 Peptide - middle region

Product Specifications

Product Name Alternative

KU80, KUB2, Ku86, NFIV, KARP1, KARP-1

UniProt

P13010

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_066964.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Carbonic Anhydrase 9 Antibody
RC-15412-01 50 μL

Recombinant Carbonic Anhydrase 9 Antibody

Sign In for Pricing
View Details
Recombinant Carbonic Anhydrase 9 Antibody
RC-15412-02 100 µL

Recombinant Carbonic Anhydrase 9 Antibody

Sign In for Pricing
View Details
Recombinant Carbonic Anhydrase 9 Antibody
RC-15412-03 1 mL

Recombinant Carbonic Anhydrase 9 Antibody

Sign In for Pricing
View Details
Recombinant CCL19 Antibody
RC-15359-01 50 μL

Recombinant CCL19 Antibody

Sign In for Pricing
View Details
Recombinant CCL19 Antibody
RC-15359-02 100 µL

Recombinant CCL19 Antibody

Sign In for Pricing
View Details
Recombinant CCL19 Antibody
RC-15359-03 1 mL

Recombinant CCL19 Antibody

Sign In for Pricing
View Details