What is the catalog number for TP73 Peptide - C-terminal region?

The catalog number for TP73 Peptide - C-terminal region is orb1998649.

What sizes are available for TP73 Peptide - C-terminal region?

TP73 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is TP73 Peptide - C-terminal region in stock?

TP73 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

TP73 Peptide - C-terminal region

Product Specifications

Product Name Alternative

P73

UniProt

O15350

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001119712.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRGGPGGGPDEWADFGF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E53P07049 100 µL

PGC Rabbit Polyclonal Antibody

Sign In for Pricing

View Details

JOT-EKA0048Hu 96 wells

Human 8-Hydroxy-desoxyguanosine,8-OHdG ELISA KIT

Sign In for Pricing

View Details

CS-O-58372 1 Each

N-Formyl Vildagliptin

Sign In for Pricing

View Details

EIA06243h 1 Kit

Human Phospholipase C Gamma 1 (PLCγ1) ELISA Kit

Sign In for Pricing

View Details

MBS1327201 Inquire

Recombinant Anabaena variabilis Elongation factor 4 (lepA), partial

Sign In for Pricing

View Details

sc-414370-LAC-2 200 µL

C2orf50 Lentiviral Activation Particles (h2)

Sign In for Pricing

View Details