What is the catalog number for TP73 Peptide - C-terminal region?

The catalog number for TP73 Peptide - C-terminal region is orb1998649.

What sizes are available for TP73 Peptide - C-terminal region?

TP73 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is TP73 Peptide - C-terminal region in stock?

TP73 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

TP73 Peptide - C-terminal region

Product Specifications

Product Name Alternative

P73

UniProt

O15350

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001119712.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRGGPGGGPDEWADFGF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP3-26657-50ul 50 µL

Human Monoclonal Claudin-18 Antibody (25E3)

Sign In for Pricing

View Details

K3969604 1.0 µg DNA

Zfp92 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing

View Details

orb1858921-01 15 nmol

RAX siRNA (Human)

Sign In for Pricing

View Details

orb1858921-02 30 nmol

RAX siRNA (Human)

Sign In for Pricing

View Details

49341056 1.0 mL

USP6NL Adenovirus (Rat)

Sign In for Pricing

View Details

TA502459AM 100 µL

KATNAL1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G1]

Sign In for Pricing

View Details