Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TP73 Peptide - middle region

TP73 Peptide - middle region

Product Specifications

Product Name Alternative

P73

UniProt

O15350

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001119712.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQQAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WASF1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
50255066 1.0 µg DNA

WASF1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human Peptidase D/Prolidase (PEPD) ELISA Kit
SL2455Hu-01 48 Tests

Human Peptidase D/Prolidase (PEPD) ELISA Kit

Sign In for Pricing
View Details
Human Peptidase D/Prolidase (PEPD) ELISA Kit
SL2455Hu-02 96 Tests

Human Peptidase D/Prolidase (PEPD) ELISA Kit

Sign In for Pricing
View Details
Mouse Anti-Human IgG Fab - HRP
orb1786798-01 100 µL

Mouse Anti-Human IgG Fab - HRP

Sign In for Pricing
View Details
Mouse Anti-Human IgG Fab - HRP
orb1786798-02 500 µL

Mouse Anti-Human IgG Fab - HRP

Sign In for Pricing
View Details
MS2734
orb1737572-01 25 mg

MS2734

Sign In for Pricing
View Details