Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TP73 Peptide - middle region

TP73 Peptide - middle region

Product Specifications

Product Name Alternative

P73

UniProt

O15350

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001119712.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQQAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pmp20 Antibody, Biotin conjugated
MBS7050014-01 0.05 mg

pmp20 Antibody, Biotin conjugated

Sign In for Pricing
View Details
pmp20 Antibody, Biotin conjugated
MBS7050014-02 0.1 mg

pmp20 Antibody, Biotin conjugated

Sign In for Pricing
View Details
pmp20 Antibody, Biotin conjugated
MBS7050014-03 5x 0.1 mg

pmp20 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Mouse Natriuretic peptides B (NPPB) ELISA Kit
GTR10326658 96 Well

Mouse Natriuretic peptides B (NPPB) ELISA Kit

Sign In for Pricing
View Details
Alpha-Galactosidase Microplate Assay Kit
E51K1098 100 Assays

Alpha-Galactosidase Microplate Assay Kit

Sign In for Pricing
View Details
Anti-Mouse TINAGL1 Polyclonal Antibody
PMN42001 100 μg

Anti-Mouse TINAGL1 Polyclonal Antibody

Sign In for Pricing
View Details