Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD14 Peptide - middle region

CD14 Peptide - middle region

Product Specifications

UniProt

P08571

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000582.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nerandomilast (BI 1015550)
C01648-5mg 5 mg

Nerandomilast (BI 1015550)

Sign In for Pricing
View Details
Chicken Melanocyte antibody ELISA Kit
MBS264113-01 48 Well

Chicken Melanocyte antibody ELISA Kit

Sign In for Pricing
View Details
Chicken Melanocyte antibody ELISA Kit
MBS264113-02 96 Well

Chicken Melanocyte antibody ELISA Kit

Sign In for Pricing
View Details
Chicken Melanocyte antibody ELISA Kit
MBS264113-03 5x 96 Well

Chicken Melanocyte antibody ELISA Kit

Sign In for Pricing
View Details
Chicken Melanocyte antibody ELISA Kit
MBS264113-04 10x 96 Well

Chicken Melanocyte antibody ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Proc shRNA (UAS) - Lentiviral mouse Proc shRNA (UAS, iRFP) plasmid
GTR15174400 1 Vial

Lentiviral mouse Proc shRNA (UAS) - Lentiviral mouse Proc shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details