Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIRT2 Peptide - middle region

SIRT2 Peptide - middle region

Product Specifications

Product Name Alternative

SIR2, SIR2L, SIR2L2

UniProt

Q8IXJ6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001180215.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKAPLSTPRLLINKEKAGQSDPFLGMIMGLGGGMDFDSKKAYRDVAWLGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

7-Chloro-2-mercaptobenzoxazole
sc-233672 5 g

7-Chloro-2-mercaptobenzoxazole

Sign In for Pricing
View Details
HOXA5 (Homeobox A5, HOX1, HOX1.3, HOX1C, MGC9376) (MaxLight 750) discontinued
247204-ML750 100 µL

HOXA5 (Homeobox A5, HOX1, HOX1.3, HOX1C, MGC9376) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Prokaryotic Rat Heat Shock Protein 60
RPU60796-01 50 µg

Prokaryotic Rat Heat Shock Protein 60

Sign In for Pricing
View Details
Prokaryotic Rat Heat Shock Protein 60
RPU60796-02 100 µg

Prokaryotic Rat Heat Shock Protein 60

Sign In for Pricing
View Details
Prokaryotic Rat Heat Shock Protein 60
RPU60796-03 1 mg

Prokaryotic Rat Heat Shock Protein 60

Sign In for Pricing
View Details
Protein Kinase C, beta 2 (PKCb2) (MaxLight 405) discontinued
P9103-18E1-ML405 100 µL

Protein Kinase C, beta 2 (PKCb2) (MaxLight 405) discontinued

Sign In for Pricing
View Details