Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIRT2 Peptide - middle region

SIRT2 Peptide - middle region

Product Specifications

Product Name Alternative

SIR2, SIR2L, SIR2L2

UniProt

Q8IXJ6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001180215.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKAPLSTPRLLINKEKAGQSDPFLGMIMGLGGGMDFDSKKAYRDVAWLGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CCL23 Antibody Pair Set
E-KAB-0184 50 µL & 100 µg

Human CCL23 Antibody Pair Set

Sign In for Pricing
View Details
Rabbit Polyclonal ZFP91 Antibody
NBP1-80863-25ul 25 µL

Rabbit Polyclonal ZFP91 Antibody

Sign In for Pricing
View Details
Slc39a13 (NM_001039196) Rat Tagged ORF Clone
RR213508 10 µg

Slc39a13 (NM_001039196) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Canine Dual oxidase 1 (DUOX1) ELISA kit
GTR10470606 96 Well

Canine Dual oxidase 1 (DUOX1) ELISA kit

Sign In for Pricing
View Details
LCN10 Human siRNA Oligo Duplex (Locus ID 414332)
SR318463 1 Kit

LCN10 Human siRNA Oligo Duplex (Locus ID 414332)

Sign In for Pricing
View Details
Tumor Necrosis Factor alpha (TNFa) (MaxLight 490)
T9160-30A-ML490 100 µL

Tumor Necrosis Factor alpha (TNFa) (MaxLight 490)

Sign In for Pricing
View Details