Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HPSE Peptide - middle region

HPSE Peptide - middle region

Product Specifications

Product Name Alternative

HPA, HPA1, HPR1, HSE1, HPSE1

UniProt

Q9Y251

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001092010.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKGYNISWELGNEPNSFLKKADIFINGSQLGEDFIQLHKLLRKSTFKNAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-AKR1D1 Antibody Picoband® (monoclonal, 6I4) (Dylight488 Conjugate)
M05278-Dylight488 100 µg

Anti-AKR1D1 Antibody Picoband® (monoclonal, 6I4) (Dylight488 Conjugate)

Sign In for Pricing
View Details
Aromatase (Cytochrome P450 19A1, CYPXIX, Cytochrome P-450AROM, Estrogen Synthase, CYP19A1, ARO1, CYAR, CYP19) (APC)
029418-APC 100 µL

Aromatase (Cytochrome P450 19A1, CYPXIX, Cytochrome P-450AROM, Estrogen Synthase, CYP19A1, ARO1, CYAR, CYP19) (APC)

Sign In for Pricing
View Details
TRIM16 Rabbit Polyclonal Antibody (Cy5.5)
orb1068083 100 µL

TRIM16 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
CEP97 Protein Vector (Mouse) (pPM-C-HA)
PV164836 500 ng

CEP97 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-SCML2 Mouse Monoclonal Antibody [Clone ID: OTI1E1]
M08958 100 µL

Anti-SCML2 Mouse Monoclonal Antibody [Clone ID: OTI1E1]

Sign In for Pricing
View Details
Human CDK3 Knockout A549 cell line
GTR15417909 1 Vial

Human CDK3 Knockout A549 cell line

Sign In for Pricing
View Details