Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBD2 Peptide - middle region

MBD2 Peptide - middle region

Product Specifications

Product Name Alternative

DMTase, NY-CO-41

UniProt

Q9UBB5

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003918.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF Antibody (PE)
orb1271087 100 Tests

TNF Antibody (PE)

Sign In for Pricing
View Details
Tissue FFPE Sections, Skin
CS810706 5x 5 µm

Tissue FFPE Sections, Skin

Sign In for Pricing
View Details
GARNL3 Polyclonal Antibody, HRP Conjugated
bs-13285R-HRP 100 µL

GARNL3 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
RPL10A Recombinant Rabbit mAb
ARM1340-01 30 µL

RPL10A Recombinant Rabbit mAb

Sign In for Pricing
View Details
RPL10A Recombinant Rabbit mAb
ARM1340-02 50 μL

RPL10A Recombinant Rabbit mAb

Sign In for Pricing
View Details
RPL10A Recombinant Rabbit mAb
ARM1340-03 100 µL

RPL10A Recombinant Rabbit mAb

Sign In for Pricing
View Details