MBD2 Peptide - middle region
MBD2 Peptide - middle region
Product Specifications
Product Name Alternative
DMTase, NY-CO-41
UniProt
Q9UBB5
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_003918.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1473835-01 0.02 mg (E-Coli)
Recombinant Staphylococcus aureus Uncharacterized lipoprotein MW0073 (MW0073)
Sign In for Pricing
View Details MBS1473835-02 0.1 mg (E-Coli)
Recombinant Staphylococcus aureus Uncharacterized lipoprotein MW0073 (MW0073)
Sign In for Pricing
View Details MBS1473835-03 0.02 mg (Yeast)
Recombinant Staphylococcus aureus Uncharacterized lipoprotein MW0073 (MW0073)
Sign In for Pricing
View Details MBS1473835-04 0.1 mg (Yeast)
Recombinant Staphylococcus aureus Uncharacterized lipoprotein MW0073 (MW0073)
Sign In for Pricing
View Details MBS1473835-05 0.02 mg (Baculovirus)
Recombinant Staphylococcus aureus Uncharacterized lipoprotein MW0073 (MW0073)
Sign In for Pricing
View Details MBS1473835-06 0.02 mg (Mammalian-Cell)
Recombinant Staphylococcus aureus Uncharacterized lipoprotein MW0073 (MW0073)
Sign In for Pricing
View Details